NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209729_1019695

Scaffold Ga0209729_1019695


Overview

Basic Information
Taxon OID3300027061 Open in IMG/M
Scaffold IDGa0209729_1019695 Open in IMG/M
Source Dataset NameForest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M3 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)810
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location
Location NameDavy Crockett National Forest, Groveton, Texas, USA
CoordinatesLat. (o)31.11Long. (o)-95.15Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000037Metagenome / Metatranscriptome4230Y
F001891Metagenome / Metatranscriptome622Y
F006915Metagenome / Metatranscriptome362Y

Sequences

Protein IDFamilyRBSSequence
Ga0209729_10196951F006915N/AMDAETRDLALLATLSLFCAGFAWSWGYVILGSVFFALGGVAALGIAERHWD
Ga0209729_10196952F000037GGAMDKDYLTLKRASASRPSGEWSDDDYDVIADGVVVGRIMKAAVSPVGTPWMWTLLLYHEGRTPTHGYEPTREAAMAAFAKSWRRE
Ga0209729_10196953F001891GGAGGMDRENSMRAIGLVLLSIAIMALLLTDADAKRRSSAQGSQAAGASRSWCAVHPRHGSENCGYTSFDQCWATIGAEGGWCRPNPFSATPYGTGYTWSGPKR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.