NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208237_1003972

Scaffold Ga0208237_1003972


Overview

Basic Information
Taxon OID3300027080 Open in IMG/M
Scaffold IDGa0208237_1003972 Open in IMG/M
Source Dataset NameForest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF009 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2031
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Harvard Forest Long Term Ecological Research (Lter) Site In Petersham, Ma, For Long-Term Soil Warming Studies

Source Dataset Sampling Location
Location NameHarvard Forest LTER, Petersham, MA, USA
CoordinatesLat. (o)42.532967Long. (o)-72.209488Alt. (m)Depth (m)0 to .1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003851Metagenome / Metatranscriptome465Y
F015067Metagenome / Metatranscriptome257Y
F026325Metagenome / Metatranscriptome198Y

Sequences

Protein IDFamilyRBSSequence
Ga0208237_10039723F026325GGAGGMMTDPASAIKREVHQLVDLQIETLRQPSPLTASDLSDYRVRSEKITTLFHELDQLRRAIFERPLRRAS
Ga0208237_10039724F003851AGGAGGMKQRKLAGASSQTNDENAERVLRALEEARHGRVNTNDPIVEQLRQCPEAFKVGEIIGKAFDSLKYSQDGGELGDRYFPPAGTVLPPPV
Ga0208237_10039725F015067N/AVIGLPLQVTFPRLKGIRWRYCTRWDEGPAAVLGISLLRLGICQPNDWSGSAVDFVERGFKRFCLQNHVAAAKRVWVGDLRITDSLFELTEQERNLVEAEREGVTDHLYVIGDYEAAASIPIGATLTRLEAEHAHLAAAFYEVFTTNLYKWMRVYDYLDAQEHAETWMEDLSEEESEASVYRKVDLEIPACIKSHSRTFKYRRARTLLQEIRPHTSVTRELIR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.