NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208861_104705

Scaffold Ga0208861_104705


Overview

Basic Information
Taxon OID3300027097 Open in IMG/M
Scaffold IDGa0208861_104705 Open in IMG/M
Source Dataset NameForest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF019 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)732
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Harvard Forest Long Term Ecological Research (Lter) Site In Petersham, Ma, For Long-Term Soil Warming Studies

Source Dataset Sampling Location
Location NameHarvard Forest LTER, Petersham, MA, USA
CoordinatesLat. (o)42.471116Long. (o)-72.17263Alt. (m)Depth (m)0 to .1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F037313Metagenome / Metatranscriptome168Y
F042445Metagenome / Metatranscriptome158Y

Sequences

Protein IDFamilyRBSSequence
Ga0208861_1047051F042445N/ATKLLAGLIVPATLAGCAQVNERMFTVDCAIGRTPLPGELQPGTAMAFDVSTSPIPLLYAPHRAIARCDSAGVVTMTVETPVDTGLSQLSTPLSTAASHVSYAP
Ga0208861_1047052F037313GAGGMKIRNFFCRFLCASLLLLAGCAQQGGGLLQPTPRQIISGKNTIVPSAAALSMEATNFCNAQAQVDYAGLVLYCEGKTPTLPLSISTNYQTETSQFSCQVYGYTNSSNQLIVPQTVTLGNCPTGTEP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.