NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0255066_1001345

Scaffold Ga0255066_1001345


Overview

Basic Information
Taxon OID3300027131 Open in IMG/M
Scaffold IDGa0255066_1001345 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8h
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4396
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location
Location NameUSA: Oregon
CoordinatesLat. (o)46.1812Long. (o)-123.1834Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003379Metagenome / Metatranscriptome490Y
F010085Metagenome / Metatranscriptome308Y
F080026Metagenome / Metatranscriptome115Y

Sequences

Protein IDFamilyRBSSequence
Ga0255066_10013452F010085AGTAGGMQIQYVSKYIALSEEGLVPRLECPMDQGSLQSNMDLDSNIFLYCLSCEYKNNIGLEVYSKIVEAIKNEI
Ga0255066_10013456F080026AGGAMAYSQEQMDFAHKIVFRLMEILKVCPNVDDKYKCHTTHQPAHKRCVDLMVLLAEITNLPEYLVYLGNNDETNKDPYGWIVAYPPAEAIVVEESNNTEKAVDLE
Ga0255066_10013458F003379N/AMKKISAFIMLIATAILSGVALNKFLNWAGKQEDFFDFDLDEDIDNEQF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.