NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209691_1009243

Scaffold Ga0209691_1009243


Overview

Basic Information
Taxon OID3300027279 Open in IMG/M
Scaffold IDGa0209691_1009243 Open in IMG/M
Source Dataset NameAnoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-B MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3269
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (83.33%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic → Anoxygenic And Chlorotrophic Microbial Mat Microbial Communities From Yellowstone National Park, Usa

Source Dataset Sampling Location
Location NameUSA: Wyoming: Yellowstone National Park
CoordinatesLat. (o)44.963Long. (o)-110.715Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002372Metagenome / Metatranscriptome566Y
F007172Metagenome / Metatranscriptome356Y
F012676Metagenome / Metatranscriptome278Y
F015735Metagenome / Metatranscriptome252Y

Sequences

Protein IDFamilyRBSSequence
Ga0209691_10092431F002372N/ARKSSHLRALLDSLDLVDIGVTYELDFYPYAIVELLRVRDDAPPLVLRSVYVQANRQWEYHSEFVLRVVEAALQLLHEYRADPSMGGAEAV
Ga0209691_10092432F015735AGGCGGMMVYHHWSVEWHPRDNPPHGLPRVVCIARRAVVDPFAGPGLFPPDIDRAVRFWNLVASGGARDHGAGYEVVWRLSVVAGDADGDAPPDGAWSDDPLYRARRRLLRWIMRSQCPIPALADHFAVEHFRSSPGYFGLE
Ga0209691_10092435F012676AGGAGMNSIKIAAGWDGSPKALTHPEHGWVRFLETRGIAYATYLSEPTGWRVVVEDEEKFMRLIPKLRKYNIHGIYEWTYDIH
Ga0209691_10092436F007172AGGAGGMNTLERRTFAAALRAAKQSAYCRTVGGFVIARLSDGTIDWFPAGQPPHRGGEEDRGAVILGKWRWNYRRWSRIA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.