Scaffold Ga0209052_1043540

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0209052_1043540

Scaffold Ga0209052_1043540

Overview

Basic Information
Taxon OID	3300027338 Open in IMG/M
Scaffold ID	Ga0209052_1043540 Open in IMG/M
Source Dataset Name	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius sp. 4 HERON ISLAND (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2431
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota	(Source: Euk_MAG)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont → Marine Gutless Worms Symbiont Microbial Communities From Various Locations

Source Dataset Sampling Location
Location Name	Germany: Marburg
Coordinates	Lat. (^o)	50.8	Long. (^o)	8.81	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007101	Metagenome	357	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209052_10435401	F007101	N/A	VERDRRAATAASRKEDKYVDLGARYISEPIAVETLGVFNASARHLLADLERKISINTRQTSYLFQRISVLVQRFNAVLLHDILPAADCTD

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.