NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209589_1041507

Scaffold Ga0209589_1041507


Overview

Basic Information
Taxon OID3300027357 Open in IMG/M
Scaffold IDGa0209589_1041507 Open in IMG/M
Source Dataset NameRoot nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1512
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Root Nodules → Root Nodule Microbial Communities Of Legume Samples Collected From Usa, Mexico And Botswana

Source Dataset Sampling Location
Location NameCalifornia, USA
CoordinatesLat. (o)34.0722Long. (o)-118.4441Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000010Metagenome7424Y
F018869Metagenome232Y

Sequences

Protein IDFamilyRBSSequence
Ga0209589_10415072F018869N/AVEGMEIEEKEKEEKMKMMEKVVECLIKGHPCLVAFVYESDNTVVSQRLVEKLKLPISIHSNQARIKFSTGQCVQEVLSDIAPTNSCHLLLRWAWLHFKTLNLDKGSLYLRDEGHEMKLKFMTPRQASKDHHRLKEKIEKERIEKEEI
Ga0209589_10415073F000010AGGAVQEVLSDIAPTNSCHLLLRWAWLHFKTLNLDKGSLYLRDEGHEMKLKFMTPRQASKDHHRLKEKIEKERIEKEEI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.