Scaffold Ga0208637_1001634

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0208637_1001634

Scaffold Ga0208637_1001634

Overview

Basic Information
Taxon OID	3300027401 Open in IMG/M
Scaffold ID	Ga0208637_1001634 Open in IMG/M
Source Dataset Name	Soil and rhizosphere microbial communities from Laval, Canada - mgLAC (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1688
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Rhizosphere Microbial Communities From Centre Inrs-Institut Armand-Frappier, Laval, Canada

Source Dataset Sampling Location
Location Name	Laval, Canada
Coordinates	Lat. (^o)	45.54	Long. (^o)	-73.72	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F038362	Metagenome / Metatranscriptome	166	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208637_10016341	F038362	N/A	PPDDRGDWLNARLDEAGRYKLVDAIVNIDMQDPAATLVPSAQNPADDKDGMRDFSPDTVRRRRRDGFKFAHDILRPAFENRWRIAREEVPTK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.