NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209247_1001418

Scaffold Ga0209247_1001418


Overview

Basic Information
Taxon OID3300027468 Open in IMG/M
Scaffold IDGa0209247_1001418 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DN (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3102
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (87.50%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location NameLake Michigan, USA
CoordinatesLat. (o)43.1998Long. (o)-86.5698Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012868Metagenome / Metatranscriptome276Y
F064668Metagenome / Metatranscriptome128N
F100345Metagenome / Metatranscriptome102N

Sequences

Protein IDFamilyRBSSequence
Ga0209247_10014181F012868GAGMKHYDYEWDLNPGGIILDPELNIDKLGWRHGDMFKVTNIDGRAMLVKLDPLV
Ga0209247_10014184F064668AGTAGMNITVYSRNRLYETFSKWDVPRDFADPMANYLVYGYEPGGFFTALLANDFFAAIQSSHPANTVEALKCLVGWINDCMPPEAYSTYNRVSEWCRLPEGHRRAILEQYGLIHTEQEEIMLTLRSESTVEPVLY
Ga0209247_10014185F100345AGGAGMSEHQRLVALLKGPDWYAHESGKDLLAVLNQGKRKRYKSMNSTADKHLSTIMYLFDKEQSVRILKTWLSTYSLPLDPDRLKTFDQFHEQFGKFITNNAGLIKSY
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.