Scaffold Ga0208987_1014447

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0208987_1014447

Scaffold Ga0208987_1014447

Overview

Basic Information
Taxon OID	3300027496 Open in IMG/M
Scaffold ID	Ga0208987_1014447 Open in IMG/M
Source Dataset Name	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O2 (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1324
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location
Location Name	El Dorado National Forest, Georgetown, California, USA
Coordinates	Lat. (^o)	38.88	Long. (^o)	-120.64	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000767	Metagenome / Metatranscriptome	899	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208987_10144472	F000767	N/A	SMSLEDQFDRLAKHHEIAIFCSFVMDNFDSEVHSRLLPRLGQNHSHLIPVEDYARLERAVGDALRQTVGADDARVLEQQLLANYSQTFQMPRSQALLLALRESLPDVADSVLTRSRKLYHGSKLSAE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.