NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208199_1004698

Scaffold Ga0208199_1004698


Overview

Basic Information
Taxon OID3300027497 Open in IMG/M
Scaffold IDGa0208199_1004698 Open in IMG/M
Source Dataset NamePeat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3569
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (83.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil → Peatlands Soil Microbial Communities From Germany And Austria, That Are Sulfate Reducing

Source Dataset Sampling Location
Location NameGermany: Weissenstadt
CoordinatesLat. (o)50.1318Long. (o)11.881Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009285Metagenome / Metatranscriptome320Y
F019806Metagenome227Y

Sequences

Protein IDFamilyRBSSequence
Ga0208199_10046984F019806AGGAGGMKSLDFLEQVDHNRKAAIYAAAHDGKMRNFAYHEGLGECRETFSRLLYTVQEGEFGVILTPDAACLAIETSPAWMEAFIQAVKEHEVLIGDHGHELVYDLREEEDEARFRGLSSPDEYELERNAPRPLVDAIAQSPFAAASLESGQNWFLVTRIEGKAPDDLIYSLSSGARGQAVDVFGLGRWKELLDILAPYGITEEGGWCPVPPERKDWLIRTQHQEDAMGAQTAAAMKPYRASLTKGAQVSVILPGSGRVRGKQRRRRGGRN
Ga0208199_10046985F009285AGGAGGMRELPYFTREEYALTKVALEGPDVPAEALALLSAWIEGERLLVDGREDVGGINFCRMDAKVMAPLPHIVASFFARRPYKRKGGHYRNWNGFYLLLYRDVEEGWKLVRIGRNTSYAQFVPLFAARSKAVEEINKRLGNDLGDHEE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.