NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0255582_1046641

Scaffold Ga0255582_1046641


Overview

Basic Information
Taxon OID3300027507 Open in IMG/M
Scaffold IDGa0255582_1046641 Open in IMG/M
Source Dataset NameAPAL treatment+control metatranscriptome co-assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1668
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. CCMP2592(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral → Coral Microbial Communities From Various Locations To Study Host-Microbial Communication

Source Dataset Sampling Location
Location NamePanama: Bocas del Toro
CoordinatesLat. (o)9.1956Long. (o)-82.1254Alt. (m)Depth (m)15
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001767Metagenome / Metatranscriptome638Y

Sequences

Protein IDFamilyRBSSequence
Ga0255582_10466411F001767AGGAGVHWCSKLQTRMRGEGDPNAAGVAQSSDKMLSVQKNNENRSLKTNRLFPTPNKPDPMPQNLAFLFTKITPEQMIYMWNVLTAIFVSQVLMVIGYCAALACFPDYWWTCTLCFGLPFSYIAIQNIYIDHDVMHGATFPVYEWQRFLTHPFADFLSLPWEEFVLEHNRHHASTVDLLIQGEFGWDPEEFHYALQQWAGPWSSNWYKYLLTVPFIPVIHFFGLNDTGSLFALEWWMHFPDEGAGGKCNKEFWSKWIPRRIKHNAFVLSLWACIWLLGTYPLGRPLSEGWRFMFTVSFFARIGYSAAWMFITNFTHSLPWNEFLAQDPGRTWPVLHNVMAMVLGGKHRWNEMLFHDVHHAFPNAVGTLSQRGRFHGWEKVHDAAAEVLHRGLWKPNGDEETQMQKTQKKRSMMMQQGK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.