Scaffold Ga0209162_1035957

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0209162_1035957

Scaffold Ga0209162_1035957

Overview

Basic Information
Taxon OID	3300027515 Open in IMG/M
Scaffold ID	Ga0209162_1035957 Open in IMG/M
Source Dataset Name	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP NP MetaG (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1895
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic → Anoxygenic And Chlorotrophic Microbial Mat Microbial Communities From Yellowstone National Park, Usa

Source Dataset Sampling Location
Location Name	USA: Wyoming: Yellowstone National Park
Coordinates	Lat. (^o)	44.963	Long. (^o)	-110.715	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F039435	Metagenome / Metatranscriptome	163	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0209162_10359571	F039435	AGGTGG	MLVAVTKPHQQFPVSLFSAEYELTTSIDGDERGRITLPPALARSGVMTQIGDELIIYCTQLSKTIWRGQIER

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.