NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209008_1005636

Scaffold Ga0209008_1005636


Overview

Basic Information
Taxon OID3300027545 Open in IMG/M
Scaffold IDGa0209008_1005636 Open in IMG/M
Source Dataset NameForest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2978
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (83.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location
Location NameAlgoma, Ontario, Canada
CoordinatesLat. (o)46.42Long. (o)-83.37Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001759Metagenome / Metatranscriptome640Y
F002337Metagenome / Metatranscriptome569Y
F008209Metagenome / Metatranscriptome337Y

Sequences

Protein IDFamilyRBSSequence
Ga0209008_10056361F001759AGAAGMTLKSALQDLRETTLAAVAGWLAKLAYLGSLRRREGGYKHWGLSLIHGEESSDRALKAAHTEVLSRVLRTPISDLQQDLQQSSQADQQNAGTYIAGMREQVKQLLPSPHDAVSERHLNSVLIALSKLEKNRKPATPSV
Ga0209008_10056362F008209AGGAGMKLTLLIIATVLMFLNTIVVPTVAHADGGGGGSNCSGSSGLCRP
Ga0209008_10056364F002337GGAGMNLAIILVVAAAVALGVILRLTITRSLQAKGNSNPARTIRPIDVEAFRNLIDPAEDQYLRGLLPPTQFREVRRARLLAMAAYVQVAGGNAAVLVRLGESVLAGGDPRFAEAARQLVDDALLLRRNTTVALLRIYMALAWPNSPFAAGRVIDRYEQVSGSAMLLGRLQNPAAAVRLSSRS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.