NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209525_1000036

Scaffold Ga0209525_1000036


Overview

Basic Information
Taxon OID3300027575 Open in IMG/M
Scaffold IDGa0209525_1000036 Open in IMG/M
Source Dataset NameForest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)52685
Total Scaffold Genes63 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)54 (85.71%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location
Location NameAlgoma, Ontario, Canada
CoordinatesLat. (o)46.42Long. (o)-83.37Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F061096Metagenome / Metatranscriptome132Y
F084928Metagenome111Y
F089211Metagenome / Metatranscriptome109N

Sequences

Protein IDFamilyRBSSequence
Ga0209525_100003627F084928AGCAGVEMEKHKILVDAKAELEKHVWGTFVEGKATVALGGSGVVVSNCEACRKRFGTNSQYLRHLSDDVLPLILRKAFEIAGVSTAK
Ga0209525_100003633F061096GGTGGMVAKYDIFKKTNNSVVWVEAVEDIVTAKKRLISLASDGTDGYRIWDSTKQQFIDPLDDCA
Ga0209525_10000368F089211GGAMPIATHSQTNLLASSTTLGTIRAMKEDSDEKVTPKDGTELSARKWIRCDTSHCGNPAVGLLALRFYCVGHFIAHCYEYLERCNCNPIKDADVVTSFSVDRFLQQCITQAGELVRPIRGFDNLDRARLFDIFLWASDLVAKRSVFKAENAASSQSSSYSAGMSRKVSAD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.