NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209527_1000198

Scaffold Ga0209527_1000198


Overview

Basic Information
Taxon OID3300027583 Open in IMG/M
Scaffold IDGa0209527_1000198 Open in IMG/M
Source Dataset NameForest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)13736
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (91.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location
Location NameAlgoma, Ontario, Canada
CoordinatesLat. (o)46.42Long. (o)-83.37Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004804Metagenome / Metatranscriptome423Y
F011773Metagenome / Metatranscriptome287Y

Sequences

Protein IDFamilyRBSSequence
Ga0209527_10001983F004804GGAGGMSMVLIFTGKWNRWYRVLRFDKGFGLFDSVRYGLWLARGRA
Ga0209527_10001988F011773AGGAGMNSSLNFLAGILSTALLAPCVAGFPQGQNNQATLAKQSSIIFSGTVNQLGAVSFVGVPQSPQTIVVRVDSVLKKPPAVSLKKGDNITVEVKDPSAFQQGAQATFYAEGWIFGSGVAVKELGHDFNPGGGTPAEKARTGEAALGQMQKQINDQDIQNRMASSDLVVIGRITDVHRWTIPKSAAARYPISEHSADWHEAVLQIKTILKGTKPKGGKMAVRFPLSRDVAWINSPKFQKQQQGIFFLKRDQVSGDPTATLGSEQVYAYTCLKPGDWLPLSDEPRVRSLLKK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.