NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208966_1008737

Scaffold Ga0208966_1008737


Overview

Basic Information
Taxon OID3300027586 Open in IMG/M
Scaffold IDGa0208966_1008737 Open in IMG/M
Source Dataset NameFreshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3027
Total Scaffold Genes14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)12 (85.71%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic → Freshwater Lentic Microbial Communities From The Great Laurentian Lakes, Mi, Usa For Biogeochemical Studies

Source Dataset Sampling Location
Location NameGreat Lakes, Michigan, USA
CoordinatesLat. (o)44.701094Long. (o)-82.854085Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001562Metagenome / Metatranscriptome670Y
F008132Metagenome / Metatranscriptome338Y
F051126Metagenome / Metatranscriptome144Y
F074872Metagenome / Metatranscriptome119Y

Sequences

Protein IDFamilyRBSSequence
Ga0208966_10087371F008132N/ATKWDTIQADVADQYVYLDEEEEYNKALDNDEDDVLGFSKAIQIDHLTDEQVDEIFNMFGD
Ga0208966_100873714F074872AGGMSVPNATILPNKKGSKMTVNGYTYKVGDLFTTLKSKKTGVIKEIIPNSSGSVRVLLEMPTKETRWTTVSNSALTGA
Ga0208966_10087374F001562AGGAGMTQFERDLTIKESFIDLLNDIYPEVKIGYSTFTPAEILECCDPIAFHIGVIEHEDYMQECGMLDDEEM
Ga0208966_10087375F051126AGGMSAKAYTIETLLVGKYYRSHSRHDEGTIIHAEKRDGIWYGENLEAYVVQVSPTRGIHDFWATVAVRVAD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.