NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209220_1000086

Scaffold Ga0209220_1000086


Overview

Basic Information
Taxon OID3300027587 Open in IMG/M
Scaffold IDGa0209220_1000086 Open in IMG/M
Source Dataset NameForest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)45268
Total Scaffold Genes48 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)29 (60.42%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location
Location NameThunder Bay, Ontario, Canada
CoordinatesLat. (o)49.08Long. (o)-89.38Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000195Metagenome / Metatranscriptome1659Y
F001972Metagenome / Metatranscriptome609Y
F036138Metagenome / Metatranscriptome170Y

Sequences

Protein IDFamilyRBSSequence
Ga0209220_100008613F000195AGGMDLTVTRQQFDAIRTAKHLPDVLKKVLDGATRNANGQVLHLTYEEATALNELASWNVHTDADGNVTTESKVFDDLVRTIMTHPEF
Ga0209220_100008615F001972GGAGGMNALTRNTLLAIALALLLLVALPRQGPVGWDFLDDFTLAFCFTYIGHWVEVALLKIPGIETPIGRVIRMLGWFAGGLWCYELGRLALLAYGRSTQELPPLVWGGVFFVALELIVHGILQARGRPNFYSGQLSEPSTL
Ga0209220_100008635F036138GAGMRGATLLTVALLAGCQARNREPDALDIGGTAAAVTPRDSADRAVLTPRVVTGPTVLVFWLAAADTLAAPDQAAALDDLTYYTDRIAPTLARHDIKLVPTNAETVYVALPNHQRRAILLSGLDYPFGYVLVQPGGDERVLAGVYADDELLDEVRVYFDLPTDTTATRPRITT
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.