NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0255120_1014846

Scaffold Ga0255120_1014846


Overview

Basic Information
Taxon OID3300027594 Open in IMG/M
Scaffold IDGa0255120_1014846 Open in IMG/M
Source Dataset NameFreshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepA_8h
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1658
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location
Location NameUSA: New York
CoordinatesLat. (o)45.0061Long. (o)-74.7949Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009526Metagenome / Metatranscriptome316N
F009679Metagenome / Metatranscriptome314Y
F013411Metagenome / Metatranscriptome271Y

Sequences

Protein IDFamilyRBSSequence
Ga0255120_10148461F013411N/AGLDLYVSNKAVSTSIDESAFIVVPSAVAIYESPVLQLSTNVVTTGEIETMLYGYLAVKVVTAGGVRRFNLT
Ga0255120_10148462F009679AGGAMALITLSELKAVLGIGDIYADAIVQAVADSAENIILSYLTFDDVSIKGVSLTSNVARFYCYDNTFVVGQALTVSKCGAPFDGSRTITTVGKDDGVTFFEAAITNANITKRQVIPNGRAVLTSQAALYDTTPEVREAAMAVACDIWITRTGTLGQQGVDFQSPAPYRLGRSMLTRVSGLLGKHLDTRGYLG
Ga0255120_10148463F009526N/AMVATISPANRKRRYANQPTQHRDGHNQLERQVMPATYITGRNLTLSINSVSYADQASTVTLERENNQQVLEVLSGRAYKTVDKTATLNVELYLDDTSSAGIISALWDAANSAPDTSLAFSFDVNGDTFTGNVFPVFPTVGGAATDVLTTSLSFVVEDGTVARA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.