 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300027609 Open in IMG/M |
| Scaffold ID | Ga0209221_1000012 Open in IMG/M |
| Source Dataset Name | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 116318 |
| Total Scaffold Genes | 96 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 70 (72.92%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Thunder Bay, Ontario, Canada | |||||||
| Coordinates | Lat. (o) | 49.08 | Long. (o) | -89.38 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F012137 | Metagenome / Metatranscriptome | 283 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209221_100001212 | F012137 | N/A | MFKISTVDTPSRRTLLVEGTFIGPWIVELDTTWRNACRNLARRKLVVDLSNVTVISHEGEDAIFDLMKKGAKFSCSGLLMKHVLKELARKKPQESQK |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |