Scaffold Ga0208736_1031978

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0208736_1031978

Scaffold Ga0208736_1031978

Overview

Basic Information
Taxon OID	3300027618 Open in IMG/M
Scaffold ID	Ga0208736_1031978 Open in IMG/M
Source Dataset Name	Polar desert microbial communities from Antarctic Dry Valleys - UQ255 (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1329
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces hirsutus	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert → Polar Desert Microbial Communities From Antarctic Dry Valleys

Source Dataset Sampling Location
Location Name	Antarctic Dry Valleys
Coordinates	Lat. (^o)	-78.0486	Long. (^o)	163.8053	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067309	Metagenome	125	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208736_10319781	F067309	AGGA	MSHIIGRPNDDLLNIMLGGHGADPEQAFIGGLEQGPEEGDGSEDRLHGEEPTVPEP

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.