Scaffold Ga0209753_1042057

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0209753_1042057

Scaffold Ga0209753_1042057

Overview

Basic Information
Taxon OID	3300027622 Open in IMG/M
Scaffold ID	Ga0209753_1042057 Open in IMG/M
Source Dataset Name	Marine microbial communities from oxygen minimum zone in mesopelagic equatorial Pacific - METZYME_3_550m (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1291
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Oxygen Minimum Zone In The Mesopelagic Equatorial Pacific

Source Dataset Sampling Location
Location Name	Pacific Ocean
Coordinates	Lat. (^o)	8.0	Long. (^o)	-156.0	Alt. (m)		Depth (m)	550
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025519	Metagenome / Metatranscriptome	201	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209753_10420573	F025519	GGA	MNDIKGNTWKYGSIKLSSMTYTFECDNEQCRRRIICLLSKYDDSEYFGKCSYCGVGRLKWVKNIDLKGVLRDHNIIVQK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.