NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208942_1002483

Scaffold Ga0208942_1002483


Overview

Basic Information
Taxon OID3300027627 Open in IMG/M
Scaffold IDGa0208942_1002483 Open in IMG/M
Source Dataset NameFreshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6442
Total Scaffold Genes22 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (50.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic → Freshwater Lentic Microbial Communities From The Great Laurentian Lakes, Mi, Usa For Biogeochemical Studies

Source Dataset Sampling Location
Location NameGreat Lakes, Michigan, USA
CoordinatesLat. (o)44.5046Long. (o)-83.045851Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004111Metagenome / Metatranscriptome452Y
F006218Metagenome / Metatranscriptome378Y
F011150Metagenome / Metatranscriptome294Y
F013409Metagenome / Metatranscriptome271N

Sequences

Protein IDFamilyRBSSequence
Ga0208942_10024831F011150N/AHHKIIENFRHDIIMRKIKQKEDKEFRNMFIKIFLIIVIAILLLAVINNYR
Ga0208942_100248311F006218GAGMGKRKEILKSCGNCHICGKEHMSNEGGWVINAEKLNFCHSLDHSCYDVYFNNVRAAEKQKVVINTENDKRMNMYIEYLKAQKCKHKYQGE
Ga0208942_10024832F013409AGGMIIMMNGTVYNLGFTVDRYDTRTCDKLFDSITYKGKTSGKNKQGVFYKSKEVFAHSCSIEKTTERENERKNKTS
Ga0208942_10024833F004111N/AMKEKIKQVNELCAANGAYINQHGKKTVSAWSKIKYFREVFGTEFGINCVIQEHSDRYVIMKCIITKCDPEHIIATGYSKQYRDKPGYLEIAETFAITRALSFMGILLEDITSMEEYKDLEIPVQPMITKGTSSANNRYDEGTINELIKKVHYAPHTAKLDFLWRANRELLDQIKIKDLATYNSILNKFNSKRDEITTQNEV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.