NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208942_1025644

Scaffold Ga0208942_1025644


Overview

Basic Information
Taxon OID3300027627 Open in IMG/M
Scaffold IDGa0208942_1025644 Open in IMG/M
Source Dataset NameFreshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1891
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic → Freshwater Lentic Microbial Communities From The Great Laurentian Lakes, Mi, Usa For Biogeochemical Studies

Source Dataset Sampling Location
Location NameGreat Lakes, Michigan, USA
CoordinatesLat. (o)44.5046Long. (o)-83.045851Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001562Metagenome / Metatranscriptome670Y
F014129Metagenome / Metatranscriptome265Y
F043387Metagenome / Metatranscriptome156Y

Sequences

Protein IDFamilyRBSSequence
Ga0208942_10256443F043387AGGGGGMMTKWDTIQADIADAYAYLDEAEKLDKHNSDTLFDEDMLSMDEIIEKSLTLDWEDSE
Ga0208942_10256445F001562AGGAGMKSQFEKDLEIKDSFIEMLDELYPKYKIGSSTFTASEILECCDPVAFAIGLLEHEEYLKETEN
Ga0208942_10256447F014129AGGMTTLIREITLSNVQADEANLIVCVFCSDYSSDKFCGKCKEYKGLMTLGEWLSYTQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.