 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300027634 Open in IMG/M |
| Scaffold ID | Ga0209905_1008808 Open in IMG/M |
| Source Dataset Name | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812S1M |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1269 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost → Thawing Permafrost Microbial Communities From The Arctic, Studying Carbon Transformations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Sweden: Kiruna | |||||||
| Coordinates | Lat. (o) | 68.3532 | Long. (o) | 19.0475 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F046921 | Metagenome | 150 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209905_10088083 | F046921 | N/A | LWIGTAVAIFLTFTGSAVTWHTLAWLASQWNLPSRVWQIGFVAFWLLPSLMLALLPLFRRTLLGGHSDSKGQTI |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |