NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209007_1000018

Scaffold Ga0209007_1000018


Overview

Basic Information
Taxon OID3300027652 Open in IMG/M
Scaffold IDGa0209007_1000018 Open in IMG/M
Source Dataset NameForest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)141393
Total Scaffold Genes133 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)97 (72.93%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location
Location NameAlgoma, Ontario, Canada
CoordinatesLat. (o)46.42Long. (o)-83.37Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017174Metagenome / Metatranscriptome242Y
F018974Metagenome / Metatranscriptome232Y
F034490Metagenome / Metatranscriptome174Y

Sequences

Protein IDFamilyRBSSequence
Ga0209007_100001813F017174GGAGMYSWENPDDRVAIVQMNSELRHAQLELLSAHCASHQLRLRFSADDLARFGQRDILRKSVQAASALSEYYSSIEKKIPEAEASSTPRTQLTEPQITVAVARVSAYLQEQRERYFYSASPLSPRQNAVMSPYFSAALLEQARVVELIGSRLPNPPFYAEAVEFGFINLPQIAHMASVTFLDVIVFNEKITERSLFHALVHAAQFEVLGLERYVNLFVRSFVNTKFHFSVPLEAHAFSLESRFVGHPADRFSVEDQVRLWIKNGRY
Ga0209007_100001889F034490GGAGGMEPTSAAAVKPAKSVIPQPESVVEVRNPEVRNDLRSDLRNAVRSAAAAERRSTGYGLPCANCRLYYPANLDVCPACNCKERVSAKVARVIPKVQPAAEPVPDTAVVEQEREAFLKQFKSQVFAAQADVASPGICTLGEHHVQGAEAASICKPCYDRLQERVDVCEAALHIDLKEAAQIIYDAVWADPSDPSKTYTNAASALIGELRKRSGVANVIGLFQPLDN
Ga0209007_100001899F018974AGGAGMAYQRLSTTRPSAQDWGLKLKTVLTTMMSVLSLLVVLLGGMQRDVLWLWIGFVCCLISGVFIQLFITRIKNDVASGRR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.