NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209482_1007010

Scaffold Ga0209482_1007010


Overview

Basic Information
Taxon OID3300027668 Open in IMG/M
Scaffold IDGa0209482_1007010 Open in IMG/M
Source Dataset NameMarine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5840
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (25.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From The West Antarctic Peninsula, For Metatranscriptomic Analysis

Source Dataset Sampling Location
Location NameAtlantic Ocean: West Antarctic Peninsula
CoordinatesLat. (o)-64.8156Long. (o)-64.0406Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016209Metagenome249Y
F028004Metagenome / Metatranscriptome193Y

Sequences

Protein IDFamilyRBSSequence
Ga0209482_10070108F028004N/AMKNFKITNLKSKVVQYMNESEKDQFFTRNSLGNYKSQNVKELRREKYNKKIHDFAFSVGILGVFTVLLFLMCNTFSFIDSLIF
Ga0209482_10070109F016209N/AMTRLDAEYLEYTTFIDYNKPHYSKFMGYQLDNKKVKAEEWLLKPQHLQSGVHTYDRKSGHFNNDISYNNRSVIVIGTELQIHRKFEHMLKTYGWQTQDDWKVELKPQYLEYYKENNNSPIIINLK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.