NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209011_1001657

Scaffold Ga0209011_1001657


Overview

Basic Information
Taxon OID3300027678 Open in IMG/M
Scaffold IDGa0209011_1001657 Open in IMG/M
Source Dataset NameForest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7994
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (84.62%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location
Location NameThunder Bay, Ontario, Canada
CoordinatesLat. (o)49.08Long. (o)-89.38Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015004Metagenome / Metatranscriptome258Y
F020232Metagenome / Metatranscriptome225Y
F045388Metagenome / Metatranscriptome153N
F066033Metagenome / Metatranscriptome127N

Sequences

Protein IDFamilyRBSSequence
Ga0209011_10016574F066033GGCGGMTTQSRAVLQRILQRRTNWAPAGESFGCPRCHAKYAVIRRQTPPGVIPTCENCDQEFPPTEYGEWLLYERADA
Ga0209011_10016575F045388GAGGVRRSQLTDDDLWRVIADNTDAMSVLIEKQFELDAEAGAPDPDTRQKLMLFNVQAIDNYDRQYRDCIAEVRRRYPSI
Ga0209011_10016576F020232GGAGGMAEPSAEPIPPDFAEAFAYAVLVYEIWTPEEPERLIQIGSRSYSIVEVCEFVDQFTDRLPERAYLKLRSYMHDYPDGKLKADLATDPSYATAVRCLRAMMERRTEDCKQRGGMKG
Ga0209011_10016577F015004GGAGGMSMAKRLALIAAGYALCVVAGFAAVTVNELRMPADVAQGSPGMVAFGDMILFVLVVGFVGLVPTWFLLKLFIEKAPRALLVIVLLVAALGSASWLAVRHMAGGLNPPNVPEAVGALLGLFIAFVAIPRMVFGPVLLVIEGITFLLVRGRVTRALLVVAMLMDLIPLGMFALHMMRATRY
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.