NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209769_1053993

Scaffold Ga0209769_1053993


Overview

Basic Information
Taxon OID3300027679 Open in IMG/M
Scaffold IDGa0209769_1053993 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1348
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location NameLake Michigan, USA
CoordinatesLat. (o)43.1998Long. (o)-86.5698Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000714Metagenome / Metatranscriptome924Y
F001125Metagenome / Metatranscriptome769Y

Sequences

Protein IDFamilyRBSSequence
Ga0209769_10539931F000714N/AEYATDKVASIEWDLHNGRQSQKRVTTLLSKIDAVKDIITEAYGDSEDQETLRSIAEALDIALTRTVEWSATIEVSGTIDLDLLADYDTDVESEIYDNLTVDTNNGNIEVIDQEVTNVREN
Ga0209769_10539935F001125GGCGGMGDRANFGFKDRKGDTVFLYGHWAGHRMLENLADAVSAAEPRWGDEEYATRIAISHLVGDEWKSETGWGISINRLADNEHKVPIINWAAKTFTLMEEDLTTEVFSITLDAFVTKYSSQPSMV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.