NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209553_1002406

Scaffold Ga0209553_1002406


Overview

Basic Information
Taxon OID3300027688 Open in IMG/M
Scaffold IDGa0209553_1002406 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)9143
Total Scaffold Genes16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (62.50%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location NameLake Michigan, USA
CoordinatesLat. (o)43.1998Long. (o)-86.5698Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008752Metagenome / Metatranscriptome328Y
F033792Metagenome / Metatranscriptome176Y
F073147Metagenome / Metatranscriptome120N

Sequences

Protein IDFamilyRBSSequence
Ga0209553_10024064F033792GGAMSISDQHEHCIEDLYAKYLQFTSVMLEDYQDIEIAGIMVTQALSMYRTVLSEEDYQRMVKSIYERRNDVKTFD
Ga0209553_10024065F008752AGAAGMSKPSTELEPQVPAEGVLKRNSWGDAITYQVTCECHDANHDHNVWVEADDHRVTVTTYTTQKSQWWRLNRWQTIWILLTKGYVEYEANISMTEQQALNYAETLKKAIQDVKNFKQS
Ga0209553_10024067F073147AGGAGMNFELYEVWAVDEAGHEELVETTSSKKEALEIADANLGLGAMEAIVYQEDENGDLHEIKRFGHG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.