NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209704_1020872

Scaffold Ga0209704_1020872


Overview

Basic Information
Taxon OID3300027693 Open in IMG/M
Scaffold IDGa0209704_1020872 Open in IMG/M
Source Dataset NameFreshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1666
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment → Freshwater Sediment Microbial Communities From Cottonwood Lakes Research Site Near Jamestown, North Dakota, Usa

Source Dataset Sampling Location
Location Namenear Jamestown, North Dakota
CoordinatesLat. (o)47.0956Long. (o)-99.1001Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001120Metagenome / Metatranscriptome772Y
F001165Metagenome / Metatranscriptome760Y
F001807Metagenome / Metatranscriptome631Y

Sequences

Protein IDFamilyRBSSequence
Ga0209704_10208721F001165N/AMSDSLRIPDSIDLQRLQAMQLVAKMKESADKHGIGFIGGFVAPDGQKFIMTNMDDEDTQALLPDNLK
Ga0209704_10208724F001120GGAMTDKSPINFDKTIAGFNLTEHGIKSFTKSIQLGPFQVTLNARESGVRGSISLPGTGLSKRNIRLF
Ga0209704_10208726F001807AGGMHVLAIEDTFIDGNDVTVTAVVDEMRLIHKSTHLDPDEYAPALCRTSFELDEGEQIPLDEDGFCDYLALLNPDWELLPIEND
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.