NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209446_1000200

Scaffold Ga0209446_1000200


Overview

Basic Information
Taxon OID3300027698 Open in IMG/M
Scaffold IDGa0209446_1000200 Open in IMG/M
Source Dataset NameBog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)14400
Total Scaffold Genes17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)15 (88.24%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil → Bog Forest Soil Microbial Communities From Calvert Island, British Columbia, Canada

Source Dataset Sampling Location
Location NameCalvert Island, British Columbia, Canada
CoordinatesLat. (o)51.62Long. (o)-128.09Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004311Metagenome / Metatranscriptome444Y
F014658Metagenome / Metatranscriptome261Y
F028953Metagenome / Metatranscriptome190Y

Sequences

Protein IDFamilyRBSSequence
Ga0209446_100020012F028953GGAGGMSLILVFARMWVRWYRVLRYDKAFTFVASVRYGLWLARS
Ga0209446_100020013F004311AGGAGGMLRVEIHDSAISLSLKLEGRFTGDDAENTRTLIRRCREGMSLVVDLTDVTFIDSMGEEVLSFFARFGAEFAASTSYTLDVCERLHLRLARDGASDTNTSGASRTNAGRRGAHARQSENEK
Ga0209446_100020015F014658GAGGMSMETRMAIEQSTPMPQLSESGVSVRYETKVFSHWDRQAWAEVAHAFTYEIAWIPERQCWRTFLCSVSKLA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.