NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209063_1002893

Scaffold Ga0209063_1002893


Overview

Basic Information
Taxon OID3300027705 Open in IMG/M
Scaffold IDGa0209063_1002893 Open in IMG/M
Source Dataset NameActive sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB19-Kit (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7964
Total Scaffold Genes18 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)17 (94.44%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Active Sludge And Wastewater Microbial Communities From Klosterneuburg, Austria

Source Dataset Sampling Location
Location NameAustria: Klosterneuburg
CoordinatesLat. (o)48.3Long. (o)16.2Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F051906Metagenome / Metatranscriptome143N
F059895Metagenome / Metatranscriptome133Y
F098921Metagenome / Metatranscriptome103N

Sequences

Protein IDFamilyRBSSequence
Ga0209063_100289311F059895AGGMTGLDATIARALSGYDAGDVLSFDSLREAANAAQLSQQQVHGQIRRALSAGFIEILTFEIDGETYEACRPTEHPDGLHRRILHYRRTSVPVVVGVAS
Ga0209063_10028934F098921AGAAGMSTPDPALTAALKVMLTDACWRCSDGGGATCDPCLSELVAAAERDAEAATVMTSLRGMFDPMTGRPAGGGW
Ga0209063_10028937F051906GGAGGVTPHAAFIRRAGARHYRCTTCHERVAPGQRVPHLNRETVRAAEYGTTVPTHDLGDDE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.