NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209188_1001906

Scaffold Ga0209188_1001906


Overview

Basic Information
Taxon OID3300027708 Open in IMG/M
Scaffold IDGa0209188_1001906 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)15994
Total Scaffold Genes27 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)15 (55.56%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Croche, Canada
CoordinatesLat. (o)46.8319Long. (o)-72.5Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000141Metagenome / Metatranscriptome1941Y
F000506Metagenome / Metatranscriptome1070Y
F007522Metagenome / Metatranscriptome349Y
F021981Metagenome / Metatranscriptome216N

Sequences

Protein IDFamilyRBSSequence
Ga0209188_100190620F000506AGGAGMAKLKITRANGEVSEHRITPGVEYAFEIKYGSGISKVLRDHERQTEIYFLAHECLRRANVVVPTFGLEFIETLDTVEVLDDEKN
Ga0209188_10019064F000141AGGAMKHAQFKCNGCKRNTEFLWLEALVIGEGFKAYQCMSCGCVGVKNIAEALHTPDADVCRCDKCGAWKFVTVVCHTCQLIGAK
Ga0209188_10019066F021981GAGMPTSTEKLFNDATTLIHERGVVYGHAIYNMERIAKSVSAYIDYPIMPHDIPIINVLQKISRLAESPGHADSIVDICAYMGIYKLCVEAEKDNEFEWRVGE
Ga0209188_10019067F007522N/AMSLQEAGLLWVAAMVVIICVYGLMQNAKDVAYWRGRHDGWTMHRRMIENKNDADIN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.