NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209075_1004503

Scaffold Ga0209075_1004503


Overview

Basic Information
Taxon OID3300027711 Open in IMG/M
Scaffold IDGa0209075_1004503 Open in IMG/M
Source Dataset NameAgricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2011 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)11143
Total Scaffold Genes17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)16 (94.12%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil → Agricultural Soil Microbial Communities From Utah And Georgia To Study Nitrogen Management

Source Dataset Sampling Location
Location NameUSA: Utah
CoordinatesLat. (o)41.7655Long. (o)-111.8143Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F054970Metagenome / Metatranscriptome139Y
F079824Metagenome / Metatranscriptome115N
F088942Metagenome / Metatranscriptome109Y
F101423Metagenome / Metatranscriptome102N

Sequences

Protein IDFamilyRBSSequence
Ga0209075_10045031F088942AGGAMTEWFRSDNTEGFDEKTLAVMNEEMQKQYDNLSDEERRNESYIDYLKEQILSSH
Ga0209075_100450317F054970N/AMTKNTPEALQKIVENLVVDLFKIDDCYNWECEECPFHLKEVEEDPYYGKHKCGWLLLRSATRKIMRK
Ga0209075_10045037F079824AGGAGGMIYGFFGSIPGCPHQRGSHALRGNGKTLCLTFVGYLDYLSGRDVISNYKTSFSEFVSTERIAEMVIYEDIRDTTILLSELQLYMNSLGVNTKELRSFVGSVIGQSRKRNTDIHYDTQRYTDVHPRIRVQTDRAFLPRKFHADGKPCQLDRCNKKHFIYLYQHDPYMEHPIVKLRADKFGALYDTNEIVALIKD
Ga0209075_10045039F101423GGTGGMFASERKPKSIERFRVGKGNPGVKAFTYRLLNKPYLDIRIFRGYKEITRIVTPDTGMRQFSVENIGTFVVPTGDYLLRQYFNRHCIYLNYNIQNSNPGEPVECEKWTQYEYPPLSPEEFQVLLEAQTVADLLSETEKDTKWIWYLLIGGIVLVGLIMLMGGS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.