Basic Information | |
---|---|
Taxon OID | 3300027715 Open in IMG/M |
Scaffold ID | Ga0208665_10190216 Open in IMG/M |
Source Dataset Name | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 646 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface → Deep Subsurface Shale Carbon Reservoir Microbial Communities From Ohio And West Virginia, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Ohio | |||||||
Coordinates | Lat. (o) | 41.3769 | Long. (o) | -82.5172 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F045183 | Metagenome / Metatranscriptome | 153 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0208665_101902161 | F045183 | GGAGG | MKLQETLKRLFNRLLHPTLRESEIIKTLSGLPGVRPFLYEFKLGPLFLISAWLLLFHANYTGAPEDWILYFFGGFAVVGVLSVHKAVMRFLYRIAQFDKPVEGQDRTIMITAETVTLLGFLM |
⦗Top⦘ |