NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209617_10000097

Scaffold Ga0209617_10000097


Overview

Basic Information
Taxon OID3300027720 Open in IMG/M
Scaffold IDGa0209617_10000097 Open in IMG/M
Source Dataset NameFreshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)32980
Total Scaffold Genes54 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)22 (40.74%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment → Freshwater And Sediment Microbial Communities From A Dead Zone In Lake Erie, Usa

Source Dataset Sampling Location
Location NameLake Erie, Canada
CoordinatesLat. (o)41.77Long. (o)-81.73Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010765Metagenome / Metatranscriptome299Y
F019449Metagenome / Metatranscriptome229Y
F067541Metagenome / Metatranscriptome125N

Sequences

Protein IDFamilyRBSSequence
Ga0209617_1000009713F067541N/AMSGITDEWALDASEILSEIPKAVTVKNVPAGTPVALNALMSQPAIMQDMETGGFMNQTSFDIKFLRTDAVANPGLIAFGNVVVYGGQEFRIMTVTDRLPSAWVIVKVQTKVQ
Ga0209617_1000009727F019449N/AMNVETFTTIVVPGVASVAYFSAGMANIYVKNYPLALMWICYAVANVCLLSTVIRK
Ga0209617_1000009728F010765N/AMSVIPPPTPDEISVSIRDIGLGVLIGSASWLIRYFCSTEKQSLGYIFRRTATAGFTALCVGMATKGYLSNDSLAFAAAGMAGYASPELVDYALLKLRKGK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.