NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209492_1045240

Scaffold Ga0209492_1045240


Overview

Basic Information
Taxon OID3300027721 Open in IMG/M
Scaffold IDGa0209492_1045240 Open in IMG/M
Source Dataset NameFreshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1549
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment → Freshwater Sediment Microbial Communities From Cottonwood Lakes Research Site Near Jamestown, North Dakota, Usa

Source Dataset Sampling Location
Location Namenear Jamestown, North Dakota
CoordinatesLat. (o)47.0956Long. (o)-99.1001Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002333Metagenome569Y
F043890Metagenome / Metatranscriptome155Y

Sequences

Protein IDFamilyRBSSequence
Ga0209492_10452401F043890N/AMQNTSSLGILNPDSINKLQIECIEEDDGSMTIHIEWDETDPDLQWWTDLGPEGQETFMINALR
Ga0209492_10452403F002333N/AMQTQVELNAAQAAIYTRTNLSRAFQDFDDTDIGGIYLRGDDCLVVRRDGSEQAYNRELIKTSFNTYTHRLKDFFSYLGPNYRGPSVWHNNAYILFKGWNYSHALGHLSSHAKLQAHWADKFIHVSNTDKVLHLLQSDQTDIGHLVAPDGLRLPNRPIDIDGDMEADDSEPVMGEPWCSCGSYQRQLSNVSDFASEIQGFKPWCIHLTWFNKYRELLCKRTEARNASPSGTPEKCVSWWYAPPADHISDGRFVLLYTNSGAQAPLTHWRTYKPKEIFTQHDAWDLFFNMMQAGYVPFPGTALPQLKSAIKKQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.