NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209261_10001647

Scaffold Ga0209261_10001647


Overview

Basic Information
Taxon OID3300027735 Open in IMG/M
Scaffold IDGa0209261_10001647 Open in IMG/M
Source Dataset NameWetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1Fresh (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6036
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment → Wetland Sediment Microbial Communities From St. Louis River Estuary, Michigan Under Dissolved Organic Matter Induced Mercury Methylation

Source Dataset Sampling Location
Location NameUSA: Michigan, St. Louis River estuary
CoordinatesLat. (o)46.6972164Long. (o)-92.3279105Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005647Metagenome / Metatranscriptome394Y

Sequences

Protein IDFamilyRBSSequence
Ga0209261_100016472F005647GGAGGMGRLKAAICFVVITTVSAHAQINPPSMTLSGMSDCIREAIATSAVEDNGNILIFSCSSTKAKALYNFLGRKVRAEVVQDRNGKFENRQFGNSACYHHIEDQSGKAADDFRCDLIMLVGDVLRD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.