NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209190_1001225

Scaffold Ga0209190_1001225


Overview

Basic Information
Taxon OID3300027736 Open in IMG/M
Scaffold IDGa0209190_1001225 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)17991
Total Scaffold Genes45 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)39 (86.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Montjoie, Canada
CoordinatesLat. (o)45.4091Long. (o)-72.0994Alt. (m)Depth (m)6
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F030989Metagenome / Metatranscriptome183Y
F069709Metagenome / Metatranscriptome123N
F073101Metagenome / Metatranscriptome120N

Sequences

Protein IDFamilyRBSSequence
Ga0209190_100122524F030989N/AMTKYIAKPALFNNKGMKEFTDAKEAIEYLNTVLNDDGVNPELEYTFIAPKTSRTQLKHAIEEYIGIGKLIVEETI
Ga0209190_10012255F073101AGGAMFTFACGSIEGLTLNQKRETLTALKKSISMELARKRELNAMVKLDKAAAAAVKRQVAIERAQARLQKLLDKASPVGKKAIKANKKPSACTVIQQEATEANAIALKFAAKKQSA
Ga0209190_10012258F069709AGGAMGFFDKYKFVNDNDLARSYFTTYGDSGKRAILSRIPMSKYDEFKSLFGNKYRLRYRGPRAHRIARGRAPSLAQSTCLKVDATHFAAYMQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.