NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209085_1016938

Scaffold Ga0209085_1016938


Overview

Basic Information
Taxon OID3300027741 Open in IMG/M
Scaffold IDGa0209085_1016938 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3554
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Croche, Canada
CoordinatesLat. (o)46.8319Long. (o)-72.5Alt. (m)Depth (m)2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002044Metagenome / Metatranscriptome599Y
F007522Metagenome / Metatranscriptome349Y
F021981Metagenome / Metatranscriptome216N

Sequences

Protein IDFamilyRBSSequence
Ga0209085_10169381F002044N/AKINRRIVRHSPEPLSKIDQHYMALHECYKAARKAGFTPEHAFWLMTEHKTFPDWVVGDGGIIPSIDPTDDEDDD
Ga0209085_10169383F007522AGGMTLKEAGLWWVATMVVIIWAYAVHENGKQRMYWIGRKDGFDMHRRMIQNKTDANNN
Ga0209085_10169384F021981N/AMPTTTEQLFNNATNLVHERGVVYGHAIYNMERIAKSVSAYIDFPIMPHDIPIINVLQKISRLAETPGHEDSIVDICAYMAIYKMCIEAEKDSEFQWREGE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.