NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209121_10097356

Scaffold Ga0209121_10097356


Overview

Basic Information
Taxon OID3300027742 Open in IMG/M
Scaffold IDGa0209121_10097356 Open in IMG/M
Source Dataset NameOil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 3 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1263
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine → Marine Microbial Communities From The Santa Barbara Channel Oil Seeps

Source Dataset Sampling Location
Location NameCoal Oil Point, Santa Barbara, CA
CoordinatesLat. (o)34.39225Long. (o)-119.845662Alt. (m)Depth (m)47
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F086602Metagenome / Metatranscriptome110Y

Sequences

Protein IDFamilyRBSSequence
Ga0209121_100973561F086602N/APFVFDKHADLPAKERPVYRLADTEMNINVREGHKVVGTVKLRAIVLHDPQGEKPAERWPVVMLTDDRQIKARTLLNEYGDHWGQEFGHRIGKHDLYLDILPPGYVLKTWRDDQGELHREVKYDQTAFFLSAWLRCLVFNLMSRFAQAMGGEYTKMWAGTLLRKFIRRPATLYLVGKELHVVFDPFPGQEELQPLLDKLNAKRTALPWLNNLVVQFSIAQDEPLHPLTEPEKRNRLFGDG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.