NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209189_1003217

Scaffold Ga0209189_1003217


Overview

Basic Information
Taxon OID3300027747 Open in IMG/M
Scaffold IDGa0209189_1003217 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)11029
Total Scaffold Genes35 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)30 (85.71%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Pseudoalteromonas → unclassified Pseudoalteromonas → Pseudoalteromonas sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Croche, Canada
CoordinatesLat. (o)46.8319Long. (o)-72.5Alt. (m)Depth (m)3
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F036210Metagenome / Metatranscriptome170Y
F061803Metagenome / Metatranscriptome131Y

Sequences

Protein IDFamilyRBSSequence
Ga0209189_100321711F036210GAGGMKSRFIGSDNRIEIQRKYIDQILGELDFMQIKDRLRDYLTKEKDKESNYALEAEIRKEAPEVLVDNWEGFDGPTTLTDGGYHHV
Ga0209189_10032178F061803GGAGMEIDITKQEAWKLMDALDAYKKDYTLTGPVNKIFDNITKKLKMVLKD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.