NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209084_1073961

Scaffold Ga0209084_1073961


Overview

Basic Information
Taxon OID3300027749 Open in IMG/M
Scaffold IDGa0209084_1073961 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1561
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (71.43%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Croche, Canada
CoordinatesLat. (o)46.8319Long. (o)-72.5Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007359Metagenome / Metatranscriptome352Y
F010746Metagenome / Metatranscriptome299Y
F035200Metagenome / Metatranscriptome172Y

Sequences

Protein IDFamilyRBSSequence
Ga0209084_10739611F010746GGAGGMTYKCSVSGEALSPERVEALKVLGVPESKWTNIKHSQVKKLRAVYAGDDGSNDIVICDAVDGGSLFDNEVVVEVENEC
Ga0209084_10739612F035200GGAGGMNVKYIVLRDGIRVSEDMHNSLPKAEVEASYWKEIIKRWPDGTKVVVKKIGE
Ga0209084_10739615F007359AGGAMKLMKQNLGAHWVIGIKGNKDEIQQFHNRVYNWGGTNGELQWMSNDFAYFWITLEKLERVMFKYIMSSLSDKLGKKFRGAKGGLKAVAMNRVKNTIDNIPNEHFVRTAQVEDIYSLGTISAEKLDTDS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.