Scaffold Ga0208304_10085284

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0208304_10085284

Scaffold Ga0208304_10085284

Overview

Basic Information
Taxon OID	3300027751 Open in IMG/M
Scaffold ID	Ga0208304_10085284 Open in IMG/M
Source Dataset Name	Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1197
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location
Location Name	Columbia River Estuary, USA
Coordinates	Lat. (^o)	46.2	Long. (^o)	-123.94	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F015419	Metagenome / Metatranscriptome	255	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208304_100852841	F015419	N/A	MKLELKITDEQGKEHLYSVVRSSSDEPKNLNDFILKALSISEDKRQLPFLIQCPNELEVFPSLKMKFENYGSPLLGDEIEAMMV

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.