NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209296_1040084

Scaffold Ga0209296_1040084


Overview

Basic Information
Taxon OID3300027759 Open in IMG/M
Scaffold IDGa0209296_1040084 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2511
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (11.11%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Archaea(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Simoncouche, Canada
CoordinatesLat. (o)48.2311Long. (o)-71.2508Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008688Metagenome / Metatranscriptome329N
F009135Metagenome / Metatranscriptome322Y
F010081Metagenome / Metatranscriptome308Y
F013524Metagenome / Metatranscriptome270Y

Sequences

Protein IDFamilyRBSSequence
Ga0209296_10400841F009135N/AMSKPKYYLKVNLPATFDDLDAEVIKKDLITYINSRNQYGALYGAKSSKKGIVVEKIIYSTNED
Ga0209296_10400842F013524N/AMKTNKEVVNRLREFTQNNCNTTLDPKLCEDIRYLCDEVDRFGVQMLLMNEYGDEDYITIQKYKSKLERCQSKLNQYESF
Ga0209296_10400843F008688N/AMNRFNKIVLGSLAAILLTAMTVNPPKIKVYLIMSYRGNDLAIEKVYLKKENAQKYCDMYKDSHNYSVEERELLE
Ga0209296_10400844F010081N/AMQDKINDIITEYSEKIRGVDKTKSIPMVVKELDVIVYDMYRQLYGLRDIRSSNYNLNSFTAENKKGHCS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.