NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209088_10001031

Scaffold Ga0209088_10001031


Overview

Basic Information
Taxon OID3300027763 Open in IMG/M
Scaffold IDGa0209088_10001031 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)18545
Total Scaffold Genes33 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)25 (75.76%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Simoncouche, Canada
CoordinatesLat. (o)48.2311Long. (o)-71.2508Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001396Metagenome / Metatranscriptome705Y
F012451Metagenome / Metatranscriptome280Y
F026484Metagenome / Metatranscriptome197Y
F071029Metagenome / Metatranscriptome122N

Sequences

Protein IDFamilyRBSSequence
Ga0209088_1000103115F001396GAGMAEVWVPVLVALITGPVVVVLQKLRKENTDQHAEARILLRVIGSKVDKVGTKIDNHIGWHDGKQE
Ga0209088_1000103128F026484GAGMTTTNDAMFEALSVAYPDSGQTLGDLLYAFWSEKGLEYRGTLAYQFFKDEGAVGETLGDLFNSYFVDVYPIQFDIENFDIGDFDEWLELEIFDRYDTVEQTLFSL
Ga0209088_1000103129F071029N/AMDNILDERQEKFLNWLLVPQSHRVPSSQEKYAIQEGVDETTLRRWKKKPMFKMEWERRVTDLQQSPERTQKILDSLYARALEGDNNSAKLYLQATNRLAPTQLHVEHSQKPSEISDAELDALIASVAHSEVESRKEQKLL
Ga0209088_100010315F012451AGGAGMGYQTMTAATLRSTVRDITDLDTEDLSDSLLNLYIRDGYYRILDLEQRWTFLETSFTFSTVANQRAYTISALTADPIASVVSITDATGIGKRLEMVGYDTLEETYLGTYDTSGDPLFYAVWQGKIHLFPKPSTVRTLTARGYREPIDWVTTGGAVDASPNLHFALVYYACSRIFQSLEDAAMAEVYKRAFDEGVQLARANVTKPTSHAYTIVSAGRTKGRPTFNGWTATLGRNFDWSPY
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.