NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209073_10164960

Scaffold Ga0209073_10164960


Overview

Basic Information
Taxon OID3300027765 Open in IMG/M
Scaffold IDGa0209073_10164960 Open in IMG/M
Source Dataset NameAgricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)826
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil → Agricultural Soil Microbial Communities From Utah And Georgia To Study Nitrogen Management

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)33.8834Long. (o)-83.4195Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002331Metagenome / Metatranscriptome569Y
F047850Metagenome / Metatranscriptome149Y

Sequences

Protein IDFamilyRBSSequence
Ga0209073_101649601F047850AGGAGVIRSFITRASVLALALALCGCALTLDATHLGVPVSLAGSPQEVDSGTAFRVTKHATYLLAGLVSLSQPNLEDVLAGQVGAGA
Ga0209073_101649602F002331N/ADYGKGNTWGGRASLGLSTITLTAGVASWKPDSATQSRTSVGGNVAFRLIGGSLLPVAINMQFGGASTSSSGVSAKATTLIGAAGISVPLPTPGFSIEPYFSPGVRYRNNGFDHSTEFGYVFGANFSFGVLGAHLAYDNERKKGGGNVGVFGVGLHAGIHLPLGM
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.