NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209770_10000327

Scaffold Ga0209770_10000327


Overview

Basic Information
Taxon OID3300027769 Open in IMG/M
Scaffold IDGa0209770_10000327 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)26609
Total Scaffold Genes45 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)17 (37.78%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location NameLake Michigan, USA
CoordinatesLat. (o)43.1998Long. (o)-86.5698Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F039637Metagenome / Metatranscriptome163N
F054031Metagenome / Metatranscriptome140Y
F058087Metagenome / Metatranscriptome135N
F093858Metagenome / Metatranscriptome106Y

Sequences

Protein IDFamilyRBSSequence
Ga0209770_1000032725F058087AGGMNTQARKIAFALILLSFVFLGMAFLTSCVNVPIPPFGERIGELGNLQLALSAKYIPVTPPESPGENGMAFAWQKYGEAKLLRDK
Ga0209770_1000032730F093858GGAGGMIDFHDPSAVCRSIGYFLDFLTITVPVISLAIFAWRIAR
Ga0209770_1000032731F054031GGAGGMSDPNWSEIEANRDRAEALPECNWTTETPETEAAVKASGSTFGIPLRETSRRLERQRDALYALLNRRATQ
Ga0209770_100003278F039637N/AMKKNTDTIDELETDDEALREAGMREGTRKASKWKMRPCVPGTISIIRSNMLEKRDEFWFVAAFAFVHIAPLEDVLAVDADPIAFNRAVRHWQLDNLDSIAAQDELSAIVGAAWNRVNAAETKAQHQSPGSTTSGK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.