NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209810_1000088

Scaffold Ga0209810_1000088


Overview

Basic Information
Taxon OID3300027773 Open in IMG/M
Scaffold IDGa0209810_1000088 Open in IMG/M
Source Dataset NameSurface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)280270
Total Scaffold Genes292 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)191 (65.41%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil → Surface Soil Microbial Communities From Centralia Pennsylvania, Which Are Recovering From An Underground Coalmine Fire.

Source Dataset Sampling Location
Location NameUSA: Pennsylvania, Centralia
CoordinatesLat. (o)40.7999Long. (o)-76.3402Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F014168Metagenome / Metatranscriptome265Y
F030611Metagenome / Metatranscriptome185Y
F081053Metagenome / Metatranscriptome114N
F097088Metagenome / Metatranscriptome104Y

Sequences

Protein IDFamilyRBSSequence
Ga0209810_1000088159F097088GGAMTFVVDRHAEPAIEVRVNFGVYAGRAATPAEIDRLAEWLLDEVEAVSIVAEERHEIDAHGEAVIHQVRIEAAEDAPGLKERLAERADHWARLCVADRHADVTDGA
Ga0209810_1000088228F014168N/AMRARALRLWLIAVLVAAAAVSVVANKTGSSSVGWLGFALFLCALALYARWRRAALAERRGRVFDREAKTDEAGARTDR
Ga0209810_1000088277F081053AGGAGVHDSRLKADELEQLRRWGNGLQHDPREEVSAAGRAIVLLIEEIERLHVVAWDRRLYPDEPPPDAHEPDLPLSLRQRLRHRLRPHLDPSD
Ga0209810_10000886F030611AGGAGMDHALKHPSGTPTPLWCTCEKPLPVHLAERKGAARSVCARCERPLRLQLRLT
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.